PDB entry 5jbt

View 5jbt on RCSB PDB site
Description: Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (APLP2)
Class: Hydrolase/Hydrolase inhibitor
Keywords: inhibitor protease serine, Hydrolase-Hydrolase inhibitor complex
Deposited on 2016-04-13, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRSS3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N2U3 (0-223)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d5jbta_
  • Chain 'X':
    Compound: Amyloid-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: APLP2, APPL2
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Amyloid-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: APLP2, APPL2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jbtA (A:)
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.