PDB entry 5jbn

View 5jbn on RCSB PDB site
Description: Crystal Structure of Apo Phosphopantetheine Adenylyltransferase (PPAT/CoaD) from E. coli
Class: transferase
Keywords: CoaD, Apo, PPAT, TRANSFERASE
Deposited on 2016-04-13, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: coaD, kdtB, yicA, b3634, JW3609
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I6 (Start-161)
      • expression tag (162-163)
    Domains in SCOPe 2.07: d5jbna1, d5jbna2
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: coaD, kdtB, yicA, b3634, JW3609
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jbnb_
  • Heterogens: SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jbnA (A:)
    mdpmqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqq
    atahlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvf
    lmpskewsfissslvkevarhqgdvthflpenvhqalmaklavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbnA (A:)
    qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
    lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
    kewsfissslvkevarhqgdvthflpenvhqalmaklavd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jbnB (B:)
    mdpmqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqq
    atahlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvf
    lmpskewsfissslvkevarhqgdvthflpenvhqalmaklavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbnB (B:)
    qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
    lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
    kewsfissslvkevarhqgdvthflpenvhqalmakl