PDB entry 5jbl

View 5jbl on RCSB PDB site
Description: structure of the bacteriophage t4 capsid assembly protease, gp21.
Deposited on 2016-04-13, released 2016-12-07
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prohead core protein protease
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06807
      • engineered mutation (63)
      • engineered mutation (103)
      • engineered mutation (158)
  • Chain 'B':
    Compound: Prohead core protein protease
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06807
      • engineered mutation (63)
      • engineered mutation (103)
      • engineered mutation (158)
  • Chain 'C':
    Compound: Prohead core protein protease
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06807
      • engineered mutation (63)
      • engineered mutation (103)
      • engineered mutation (158)
  • Chain 'D':
    Compound: Prohead core protein protease
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06807
      • engineered mutation (63)
      • engineered mutation (103)
      • engineered mutation (158)
  • Chain 'E':
    Compound: Prohead core protein protease
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06807
      • engineered mutation (63)
      • engineered mutation (103)
      • engineered mutation (158)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jblA (A:)
    mgsshhhhhhssglvprgsmnepqllietwgqpgeiidgvpmleshdgkdlglkpglyie
    giflqaevvnrnkrlypkrilekavkdyineqvltkqalgelnappranvdpmqaaiiie
    dmwwkgndvygrarviegdhgpgdklaaniragwipgvasrglgsltdtnegyrivnegf
    kltvgvdavwgpsapdawvtpkeitesqtaeadtsaddaymalaeamkkal
    

    Sequence, based on observed residues (ATOM records):
    >5jblA (A:)
    nepqllietwgqpgeiidgvpmlesglkpglyiegiflqaevvnrnkrlypkrilekavk
    dyineqvltkqalgelnappranvdpmqaaiiiedmwwkgndvygrarviegdhgpgdkl
    aaniragwipgvasrglgsltdtnegyrivnegfkltvgvdavwg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5jblB (B:)
    mgsshhhhhhssglvprgsmnepqllietwgqpgeiidgvpmleshdgkdlglkpglyie
    giflqaevvnrnkrlypkrilekavkdyineqvltkqalgelnappranvdpmqaaiiie
    dmwwkgndvygrarviegdhgpgdklaaniragwipgvasrglgsltdtnegyrivnegf
    kltvgvdavwgpsapdawvtpkeitesqtaeadtsaddaymalaeamkkal
    

    Sequence, based on observed residues (ATOM records):
    >5jblB (B:)
    nepqllietwgqpgeiidgvpmlglkpglyiegiflqaevvnrnkrlypkrilekavkdy
    ineqvltkqalgelnappranvdpmqaaiiiedmwwkgndvygrarviegdhgpgdklaa
    niragwipgvasrglgsltdtnegyrivnegfkltvgvdavwgp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5jblC (C:)
    mgsshhhhhhssglvprgsmnepqllietwgqpgeiidgvpmleshdgkdlglkpglyie
    giflqaevvnrnkrlypkrilekavkdyineqvltkqalgelnappranvdpmqaaiiie
    dmwwkgndvygrarviegdhgpgdklaaniragwipgvasrglgsltdtnegyrivnegf
    kltvgvdavwgpsapdawvtpkeitesqtaeadtsaddaymalaeamkkal
    

    Sequence, based on observed residues (ATOM records):
    >5jblC (C:)
    nepqllietwgqpgeiidgvpmlesglkpglyiegiflqaevvnrnkrlypkrilekavk
    dyineqvltkqalgelnappranvdpmqaaiiiedmwwkgndvygrarviegdhgpgdkl
    aaniragwipgvasrglgsltdtnegyrivnegfkltvgvdavwgp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5jblD (D:)
    mgsshhhhhhssglvprgsmnepqllietwgqpgeiidgvpmleshdgkdlglkpglyie
    giflqaevvnrnkrlypkrilekavkdyineqvltkqalgelnappranvdpmqaaiiie
    dmwwkgndvygrarviegdhgpgdklaaniragwipgvasrglgsltdtnegyrivnegf
    kltvgvdavwgpsapdawvtpkeitesqtaeadtsaddaymalaeamkkal
    

    Sequence, based on observed residues (ATOM records):
    >5jblD (D:)
    nepqllietwgqpgeiidgvpmlesglkpglyiegiflqaevvnrnkrlypkrilekavk
    dyineqvltkqalgelnappranvdpmqaaiiiedmwwkgndvygrarviegdhgpgdkl
    aaniragwipgvasrglgsltdtnegyrivnegfkltvgvdavwgp
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5jblE (E:)
    mgsshhhhhhssglvprgsmnepqllietwgqpgeiidgvpmleshdgkdlglkpglyie
    giflqaevvnrnkrlypkrilekavkdyineqvltkqalgelnappranvdpmqaaiiie
    dmwwkgndvygrarviegdhgpgdklaaniragwipgvasrglgsltdtnegyrivnegf
    kltvgvdavwgpsapdawvtpkeitesqtaeadtsaddaymalaeamkkal
    

    Sequence, based on observed residues (ATOM records):
    >5jblE (E:)
    nepqllietwgqpgeiidgvpmlesglkpglyiegiflqaevvnrnkrlypkrilekavk
    dyineqvltkqalgelnappranvdpmqaaiiiedmwwkgndvygrarviegdhgpgdkl
    aaniragwipgvasrglgsltdtnegyrivnegfkltvgvdavwgp