PDB entry 5jbf

View 5jbf on RCSB PDB site
Description: 4,6-alpha-glucanotransferase gtfb (d1015n mutant) from lactobacillus reuteri 121 complexed with maltopentaose
Deposited on 2016-04-13, released 2017-01-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inactive glucansucrase
    Species: Lactobacillus reuteri [TaxId:1598]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SBM0 (0-853)
      • cloning artifact (0)
      • engineered mutation (254)
  • Chain 'B':
    Compound: Inactive glucansucrase
    Species: Lactobacillus reuteri [TaxId:1598]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SBM0 (0-853)
      • cloning artifact (0)
      • engineered mutation (254)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5jbfA (A:)
    mgpgtwenmafaqdssainnidgylsytdwyrpygtsqdgktwykttamdwrpllmyiwp
    skdvqaqfikyfvnngyenanygltkdtvaninkdtnttvlanmaqnlryvieqsiaank
    gtsklandinsfaatvpelsasselslqsmpnyrpdksgtidsdqvifvnnnskdprkgn
    tsyadsnyrlmnrtinnqagnnnsdnspellvgndidnsnpvvqaenlnweyfllnygkl
    mgynpdgnfdgfrvnaadnidadvldqmgqlmndmyhtkgnpqnandhlsynegyhsgaa
    qmlnekgnpqlymdsgefytlenvlgrannrdnignlitnsivnrqndtteneatpnwsf
    vtnhdqrknlinrliikdhsnipdimgsaykveyanqawqefyadqektnkqyaqynvpa
    qyaillsnkdtvpqvyygdlynetaqymqeksiyydaittlmrarkqfvsggqtmtklnn
    nllasvrygkgvvdansngtdklsrtsgmavlvgndsnmaqqsvainmgrahanqqyrnl
    idttengltydadnsenpailttdsngilkvtvkgysnpyvsgylgvwvpvisgdqdvtt
    nasdvvankektfesnaaldshmiyedfslfqpeptsvenhaynviaknaslfsdlgitd
    fwmapaytpfgrsrynegysmtdrynlgttanptkygsgeelantiaalhkaglkvqedi
    vmnqmigfsgqeavtvtrtnnrgmqihvngqtyanqiyfayttgggngqetyggkylael
    qknypdlfttkaistgvapdptvrinkwsakyqngtslqnigiglavklangdyaylnsg
    dnkafntllptais
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5jbfB (B:)
    mgpgtwenmafaqdssainnidgylsytdwyrpygtsqdgktwykttamdwrpllmyiwp
    skdvqaqfikyfvnngyenanygltkdtvaninkdtnttvlanmaqnlryvieqsiaank
    gtsklandinsfaatvpelsasselslqsmpnyrpdksgtidsdqvifvnnnskdprkgn
    tsyadsnyrlmnrtinnqagnnnsdnspellvgndidnsnpvvqaenlnweyfllnygkl
    mgynpdgnfdgfrvnaadnidadvldqmgqlmndmyhtkgnpqnandhlsynegyhsgaa
    qmlnekgnpqlymdsgefytlenvlgrannrdnignlitnsivnrqndtteneatpnwsf
    vtnhdqrknlinrliikdhsnipdimgsaykveyanqawqefyadqektnkqyaqynvpa
    qyaillsnkdtvpqvyygdlynetaqymqeksiyydaittlmrarkqfvsggqtmtklnn
    nllasvrygkgvvdansngtdklsrtsgmavlvgndsnmaqqsvainmgrahanqqyrnl
    idttengltydadnsenpailttdsngilkvtvkgysnpyvsgylgvwvpvisgdqdvtt
    nasdvvankektfesnaaldshmiyedfslfqpeptsvenhaynviaknaslfsdlgitd
    fwmapaytpfgrsrynegysmtdrynlgttanptkygsgeelantiaalhkaglkvqedi
    vmnqmigfsgqeavtvtrtnnrgmqihvngqtyanqiyfayttgggngqetyggkylael
    qknypdlfttkaistgvapdptvrinkwsakyqngtslqnigiglavklangdyaylnsg
    dnkafntllptais