PDB entry 5jbc

View 5jbc on RCSB PDB site
Description: Crystal structure of factor IXa variant V16I K98T Y177T I213V in complex with PPACK
Class: hydrolase
Keywords: Crystal structure of factor IXa variant K98T in complex with EGR-chloromethylketone, hydrolase
Deposited on 2016-04-13, released 2016-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jbce_
  • Chain 'S':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-234)
      • engineered mutation (0)
      • engineered mutation (84)
      • engineered mutation (164)
      • engineered mutation (202)
    Domains in SCOPe 2.06: d5jbcs_
  • Heterogens: CA, 0G6, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >5jbcE (E:)
cnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

    Sequence, based on observed residues (ATOM records): (download) 
    >5jbcE (E:)
cnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvs

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jbcS (S:)
ivggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgivswgeecamkgkygiytkvsryvnwikektklt