PDB entry 5jb7

View 5jb7 on RCSB PDB site
Description: a simplified bpti variant containing 24 alanines out of 58 residues
Deposited on 2016-04-13, released 2017-04-19
The last revision was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-End)
      • variant (2)
      • variant (7)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (38)
      • variant (45)
      • variant (48-50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55)
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • variant (2)
      • variant (7)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (38)
      • variant (45)
      • variant (48-50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55-56)
  • Chain 'C':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • variant (2)
      • variant (7)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (38)
      • variant (45)
      • variant (48-50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55-56)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jb7A (A:)
    rpafcleapyagpgaaaiiryfynaaagaaqafvyggvaakrnnfasaaaalaacaaa
    

    Sequence, based on observed residues (ATOM records):
    >5jb7A (A:)
    rpafcleapyagpgaaaiiryfynaaagaaqafvyggvaakrnnfasaaaalaaca
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5jb7B (B:)
    rpafcleapyagpgaaaiiryfynaaagaaqafvyggvaakrnnfasaaaalaacaaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5jb7C (C:)
    rpafcleapyagpgaaaiiryfynaaagaaqafvyggvaakrnnfasaaaalaacaaa