PDB entry 5jay

View 5jay on RCSB PDB site
Description: Crystal Structure of an 8-amino-7-oxononanoate Synthase from Burkholderia xenovorans
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2016-04-12, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: bioF, Bxeno_A0198, Bxe_A4264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q146K3 (8-End)
      • expression tag (5-7)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5jaya1, d5jaya2
  • Chain 'B':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: bioF, Bxeno_A0198, Bxe_A4264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q146K3
      • engineered mutation (248)
    Domains in SCOPe 2.07: d5jayb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jayA (A:)
    mahhhhhhmhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylgl
    aahpqliaaiaegaqrygagsggshllgghsrahaqleddlaefvggfvenaralyfstg
    ymanlatltalagrgttlfsdalnhaslidgarlsradvqiyphcdtdalsamleasdad
    vkvivsdtvfsmdgdiaplprllelaeqhgawlivddahgfgvlgpqgrgaiaqaalrsp
    nlisigtldkaagvsgafvaahetviewlvqrarpyifttasvpaaahavsaslriigge
    egdarrahlqqligrtramlkatpwlpvdshtavqpliigandatleiaatldraglwvp
    airpptvptgtsrlrislsaahsqadldrleaglqqlgakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jayA (A:)
    hhhmhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylglaahpq
    liaaiaegaqrygagsghsrahaqleddlaefvggfvenaralyfstgymanlatltala
    grgttlfsdalnhaslidgarlsradvqiyphcdtdalsamleasdadvkvivsdtvfsm
    dgdiaplprllelaeqhgawlivddahgfgvlgpqgrgaiaqaalrspnlisigtldkaa
    gvsgafvaahetviewlvqrarpyifttasvpaaahavsaslriiggeegdarrahlqql
    igrtramlkatpwlpvdshtavqpliigandatleiaatldraglwvpairpptvptgts
    rlrislsaahsqadldrleaglqql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jayB (B:)
    mahhhhhhmhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylgl
    aahpqliaaiaegaqrygagsggshllgghsrahaqleddlaefvggfvenaralyfstg
    ymanlatltalagrgttlfsdalnhaslidgarlsradvqiyphcdtdalsamleasdad
    vkvivsdtvfsmdgdiaplprllelaeqhgawlivddahgfgvlgpqgrgaiaqaalrsp
    nlisigtldkaagvsgafvaahetviewlvqrarpyifttasvpaaahavsaslriigge
    egdarrahlqqligrtramlkatpwlpvdshtavqpliigandatleiaatldraglwvp
    airpptvptgtsrlrislsaahsqadldrleaglqqlgakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jayB (B:)
    lldtlaeglkeidaaahmtvdgraiigfasndylglaahpqliaaiaegaqrygagsggs
    gghsrahaqleddlaefvggfvenaralyfstgymanlatltalagrgttlfsdalnhas
    lidgarlsradvqiyphcdtdalsamleasdadvkvivsdtvfsmdgdiaplprllelae
    qhgawlivddahgfgvlgpqgrgaiaqaalrspnlisigtldkaagvsgafvaahetvie
    wlvqrartasvpaaahavsaslriiggeegdarrahlqqligrtramlkatpwlpvdsht
    avqpliigandatleiaatldraglwvpairpptvptgtsrlrislsaahsqadldrlea
    glqq