PDB entry 5jaq

View 5jaq on RCSB PDB site
Description: yersinia pestis fabv variant t276c
Deposited on 2016-04-12, released 2016-05-25
The last revision was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Yersinia pestis [TaxId:632]
    Gene: fabV, YPO4104, y4119, YP_4011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Z9U1 (7-405)
      • expression tag (1-6)
      • engineered mutation (282)
  • Heterogens: NAI, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5jaqA (A:)
    rgshmlemiikprvrgficvtahptgceanvkkqidyvttegpiangpkrvlvigastgy
    glaaritaafgcgadtlgvfferpgeegkpgtsgwynsaafhkfaaqkglyaksingdaf
    sdeikqltidaikqdlgqvdqviyslasprrthpktgevfnsalkpignavnlrgldtdk
    evikesvlqpatqseidstvavmggedwqmwidalldagvlaegaqttaftylgekithd
    iywngsigaakkdldqkvlaireslaahgggdarvsvlkavvcqassaipmmplylsllf
    kvmkekgthegcieqvyslykdslcgdsphmdqegrlradykeldpevqnqvqqlwdqvt
    ndniyqltdfvgykseflnlfgfgidgvdydadvnpdvkipnliqg
    

    Sequence, based on observed residues (ATOM records):
    >5jaqA (A:)
    gshmlemiikprvrgficvtahptgceanvkkqidyvttegpiangpkrvlvigastgyg
    laaritaafgcgadtlgvfferpgeegkpgtsgwynsaafhkfaaqkglyaksingdafs
    deikqltidaikqdlgqvdqviyslasprrthpktgevfnsalkpignavnlrgldtdke
    vikesvlqpatqseidstvavmggedwqmwidalldagvlaegaqttaftylgekithdi
    ywngsigaakkdldqkvlaireslaahgggdarvsvlkavvcqassaipmmplylsllfk
    vmkekgthegcieqvyslykdslcgdsphmdqegrlradykeldpevqnqvqqlwdqvtn
    dniyqltdfvgykseflnlfgfgidgvdydadvnpdvkipnliqg