PDB entry 5jag

View 5jag on RCSB PDB site
Description: LeuT T354H mutant in the outward-oriented, Na+-free Return State
Class: transport protein
Keywords: NSS family, apo state, transport protein
Deposited on 2016-04-12, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: snf, aq_2077
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered mutation (353)
    Domains in SCOPe 2.07: d5jaga_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jagA (A:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffaglhssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesagtlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jagA (A:)
    krehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiew
    amgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikfl
    vglvpepptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
    iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
    avgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaff
    gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffaglhssiaimqpmiaf
    ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
    fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipthwtvwitrfyii
    glflfltflvflaerr