PDB entry 5ja8

View 5ja8 on RCSB PDB site
Description: Crystal structure of the HigB2 toxin in complex with Nb2
Class: toxin
Keywords: toxin-antitoxin system, toxin
Deposited on 2016-04-12, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KMA6 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: Nanobody 2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA8 (0-End)
    Domains in SCOPe 2.07: d5ja8b1, d5ja8b2
  • Chain 'C':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KMA6 (1-110)
      • expression tag (0)
  • Chain 'D':
    Compound: Nanobody 2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA8 (0-126)
    Domains in SCOPe 2.07: d5ja8d1, d5ja8d2
  • Chain 'E':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KMA6 (1-110)
      • expression tag (0)
  • Chain 'F':
    Compound: Nanobody 2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA8 (0-126)
    Domains in SCOPe 2.07: d5ja8f1, d5ja8f2
  • Chain 'G':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KMA6 (1-110)
      • expression tag (0)
  • Chain 'H':
    Compound: Nanobody 2
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA8 (0-End)
    Domains in SCOPe 2.07: d5ja8h1, d5ja8h2
  • Heterogens: PO4, ACT, EDO, EPE, PDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ja8B (B:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ja8B (B:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    s
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ja8D (D:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    shhhhhh
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ja8F (F:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    shhhhhh
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ja8H (H:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ja8H (H:)
    qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
    adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs
    sh