PDB entry 5ja7

View 5ja7 on RCSB PDB site
Description: Human cathepsin K mutant C25S in complex with the allosteric effector NSC94914
Class: hydrolase
Keywords: allostery cysteine peptidase proteolysis enzyme regulation collagenase, hydrolase
Deposited on 2016-04-12, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (Start-222)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5ja7a_
  • Chain 'B':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-222)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5ja7b_
  • Heterogens: 6HM, SO4, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ja7A (A:)
    yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
    lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
    ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
    kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ja7A (A:)
    ipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqnl
    vdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyrei
    pegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqk
    gnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ja7B (B:)
    yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
    lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
    ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
    kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm