PDB entry 5ja5

View 5ja5 on RCSB PDB site
Description: crystal structure of the rice topless related protein 2 (tpr2) n- terminal topless domain (1-209) l111a and l130a mutant in complex with rice d53 repressor ear peptide motif
Deposited on 2016-04-12, released 2017-07-05
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein TPR1
    Species: Oryza sativa [TaxId:4530]
    Gene: TPR1, ASPR2, TPR2, Os01g0254100, LOC_Os01g15020, OsJ_01134, OSNPB_010254100, P0705D01.10-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBT9 (0-End)
      • engineered mutation (110)
      • engineered mutation (129)
  • Chain 'B':
    Compound: The rice D53 peptide (a.a. 794-808)
    Species: Oryza sativa, synthetic [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA5 (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ja5A (A:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneeaykeitqllt
    lenfreneqaskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsln
    wqhqlcknprpnpdiktlftdhtctppng
    

    Sequence, based on observed residues (ATOM records):
    >5ja5A (A:)
    msslsrelvflilqfldeekfketvhkleqesgfffnmkyfeekvhagewdevekylsgf
    tkvddnrysmkiffeirkqkylealdrhdrakavdilvkdlkvfstfneeaykeitqllt
    lenfreneqaskygdtksarsimlielkklieanplfreklvfptlkasrlrtlinqsln
    wqhqlcknpriktlftdhtct
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ja5B (B:)
    dnliyldlnlqdwdd
    

    Sequence, based on observed residues (ATOM records):
    >5ja5B (B:)
    dnliyld