PDB entry 5ja4

View 5ja4 on RCSB PDB site
Description: Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
Class: chaperone
Keywords: DNA repair and histone chaperone, CHAPERONE
Deposited on 2016-04-11, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ja4a_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ja4b_
  • Chain 'C':
    Compound: DNA replication licensing factor mcm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCM2, BM28, CCNL1, CDCL1, KIAA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tonsoku-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TONSL, IKBR, NFKBIL2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ja4A (A:)
    stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ja4A (A:)
    stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
    vtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ja4B (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ja4B (B:)
    kggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavt
    ytehakrktvtamdvvyalkrqgrtlygf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.