PDB entry 5ja1

View 5ja1 on RCSB PDB site
Description: EntF, a Terminal Nonribosomal Peptide Synthetase Module Bound to the MbtH-Like Protein YbdZ
Class: ligase
Keywords: nonribosomal peptide synthetase, nrps, condensation, adenylation, pcp, thioesterase, mbth-like protein, phosphopantetheine, biosynthetic protein, ligase
Deposited on 2016-04-11, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Enterobactin synthase component F
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: entF, b0586, JW0578
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11454
• Chain 'B':
  Compound: Enterobactin biosynthesis protein YbdZ
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: ybdZ, b4511, JW0577
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18393
  Domains in SCOPe 2.07: d5ja1b_
• Heterogens: 75C, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5ja1B (B:)
  ghmafsnpfddpqgafyilrnaqgqfslwpqqcvlpagwdivcqpqsqascqqwleahwr
  tltptnftqlqeaq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ja1B (B:)
  fsnpfddpqgafyilrnaqgqfslwpqqcvlpagwdivcqpqsqascqqwleahwrtltp
  tnftql