PDB entry 5j9o

View 5j9o on RCSB PDB site
Description: tRNA guanine Transglycosylase (TGT) in co-crystallized complex with 1-(2-(methylamino)-1H-benzo[d]imidazol-6-yl)guanidine
Class: transferase
Keywords: Benzimidazole-derivatives, shigellosis, TRANSFERASE, TRANSFERASE INHIBITOR
Deposited on 2016-04-10, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • conflict (311)
    Domains in SCOPe 2.07: d5j9oa_
  • Heterogens: ZN, GOL, 6H8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j9oA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9oA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslsskqseegvtfkshldgsr
    hmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeq
    aenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlp
    ddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlk
    pldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsq
    faqdfraryfa