PDB entry 5j9f

View 5j9f on RCSB PDB site
Description: Human GAR transformylase in complex with GAR and (4-{[2-(2-Amino-4-oxo-4,7-dihydro-3H-pyrrolo[2,3-d]pyrimidin-6-yl)ethyl]amino}benzoyl)-L-glutamic acid (AGF183)
Class: ligase/ligase inhibitor
Keywords: gar transformylase, antifolate, ligase-ligase inhibitor complex
Deposited on 2016-04-09, released 2016-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trifunctional purine biosynthetic protein adenosine-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GART, PGFT, PRGS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (1-End)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d5j9fa_
  • Heterogens: GAR, 83A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j9fA (A:)
    marvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
    lyknrvefdsaidlvleefsidivclagfmrilsgpfvakwngkmlnihpsllpsfkgsn
    aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
    alqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9fA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvakwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv