PDB entry 5j9b

View 5j9b on RCSB PDB site
Description: Crystal structure of peroxiredoxin Asp f3
Class: oxidoreductase
Keywords: peroxiredoxin, Aspergillus, OXIDOREDUCTASE
Deposited on 2016-04-08, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxiredoxin Asp f3
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: pmp20, AFUA_6G02280
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43099 (2-168)
      • expression tag (1)
      • expression tag (169)
  • Chain 'B':
    Compound: peroxiredoxin Asp f3
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: pmp20, AFUA_6G02280
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43099 (Start-168)
      • expression tag (169-170)
    Domains in SCOPe 2.07: d5j9bb1, d5j9bb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j9bB (B:)
    mgsglkagdsfpsdvvfsyipwsedkgeitacgipinynaskewadkkvilfalpgaftp
    vcsarhvpeyieklpeirakgvdvvavlayndayvmsawgkanqvtgddilflsdpdarf
    sksigwadeegrtkryalvidhgkityaalepaknhlefssaetvlkhlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j9bB (B:)
    glkagdsfpsdvvfsyipwsedkgeitacgipinynaskewadkkvilfalpgaftpvcs
    arhvpeyieklpeirakgvdvvavlayndayvmsawgkanqvtgddilflsdpdarfsks
    igwadeegrtkryalvidhgkityaalepaknhlefssaetvlkhlhh