PDB entry 5j94

View 5j94 on RCSB PDB site
Description: Human cathepsin K mutant C25S in complex with the allosteric effector NSC13345
Class: hydrolase
Keywords: cysteine proteases, allosteric regulation, hydrolase
Deposited on 2016-04-08, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-222)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d5j94a_
  • Heterogens: 1XF, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5j94A (A:)
    yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
    lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
    ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
    kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm