PDB entry 5j93

View 5j93 on RCSB PDB site
Description: Five minutes iron loaded Rana Catesbeiana H' ferritin variant E57A/E136A/D140A
Class: oxidoreductase
Keywords: Rana Catesbeiana, ferritin variant, ferroxidase activity, M type, H' type, oxidoreductase activity, iron, Oxidoreductase
Deposited on 2016-04-08, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Lithobates catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (57)
      • engineered mutation (136)
      • engineered mutation (140)
    Domains in SCOPe 2.07: d5j93a_
  • Heterogens: FE2, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j93A (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehshaer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleaqvkaikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j93A (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehshaere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleaqvkaikrigdfitnlkrlglpengmgeylfdkhsv