PDB entry 5j92

View 5j92 on RCSB PDB site
Description: Crystal structure of a putative alpha-ketoglutarate dependent 2,4-D dioxygenase from Burkholderia xenovorans
Class: oxidoreductase
Keywords: SSGCID, alpha-ketoglutarate dependent dioxygenase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-04-08, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative alpha KG dependent 2,4-D dioxygenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B2152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j92a_
  • Chain 'B':
    Compound: Putative alpha KG dependent 2,4-D dioxygenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B2152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j92b_
  • Chain 'C':
    Compound: Putative alpha KG dependent 2,4-D dioxygenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B2152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j92c_
  • Chain 'D':
    Compound: Putative alpha KG dependent 2,4-D dioxygenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B2152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j92d_
  • Heterogens: FE2, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j92A (A:)
    mahhhhhhmslnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidd
    dqllafaagfgplqvavsystrpedhrlapmindisnlskenqtyrpgdrrrmnnltsrr
    whsdasylplparysfllsyivpavggqtqfadmraaydklpdhlrkvveglschydima
    sraaagfydasdeerkalapcihelvrthpisgrkslylsshathvvgwpepegrdllre
    ltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetdvremhrattlddrtwtrgs
    nqpvaasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j92A (A:)
    mslnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaa
    gfgplqvdrrrmnnltsrrwhsdasylplparysfllsyivpavggqtqfadmraaydkl
    pdhlrkvveglschydimasraaagfydasdeerkalapcihelvrthpisgrkslylss
    hathvvgwpepegrdllreltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetd
    vremhrattlddrtwtrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j92B (B:)
    mahhhhhhmslnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidd
    dqllafaagfgplqvavsystrpedhrlapmindisnlskenqtyrpgdrrrmnnltsrr
    whsdasylplparysfllsyivpavggqtqfadmraaydklpdhlrkvveglschydima
    sraaagfydasdeerkalapcihelvrthpisgrkslylsshathvvgwpepegrdllre
    ltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetdvremhrattlddrtwtrgs
    nqpvaasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j92B (B:)
    slnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaag
    fgplqvavdrrrmnnltsrrwhsdasylplparysfllsyivpavggqtqfadmraaydk
    lpdhlrkvveglschydimasraaagfydasdeerkalapcihelvrthpisgrkslyls
    shathvvgwpepegrdllreltefatqpqfvyshewsvrdlvmwdnralmhrgrphipet
    dvremhrattlddrtwtrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j92C (C:)
    mahhhhhhmslnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidd
    dqllafaagfgplqvavsystrpedhrlapmindisnlskenqtyrpgdrrrmnnltsrr
    whsdasylplparysfllsyivpavggqtqfadmraaydklpdhlrkvveglschydima
    sraaagfydasdeerkalapcihelvrthpisgrkslylsshathvvgwpepegrdllre
    ltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetdvremhrattlddrtwtrgs
    nqpvaasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j92C (C:)
    slnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaag
    fgplqvavdrrrmnnltsrrwhsdasylplparysfllsyivpavggqtqfadmraaydk
    lpdhlrkvveglschydimasraaagfydasdeerkalapcihelvrthpisgrkslyls
    shathvvgwpepegrdllreltefatqpqfvyshewsvrdlvmwdnralmhrgrphipet
    dvremhrattlddrtwtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j92D (D:)
    mahhhhhhmslnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidd
    dqllafaagfgplqvavsystrpedhrlapmindisnlskenqtyrpgdrrrmnnltsrr
    whsdasylplparysfllsyivpavggqtqfadmraaydklpdhlrkvveglschydima
    sraaagfydasdeerkalapcihelvrthpisgrkslylsshathvvgwpepegrdllre
    ltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetdvremhrattlddrtwtrgs
    nqpvaasva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j92D (D:)
    slnveaahpfiaarihgldlskplsderiveieqasgqypvlifprqyidddqllafaag
    fgplqvavrrrmnnltsrrwhsdasylplparysfllsyivpavggqtqfadmraaydkl
    pdhlrkvveglschydimasraaagfydasdeerkalapcihelvrthpisgrkslylss
    hathvvgwpepegrdllreltefatqpqfvyshewsvrdlvmwdnralmhrgrphipetd
    vremhrattlddrtwtr