PDB entry 5j8y

View 5j8y on RCSB PDB site
Description: Crystal structure of the Scm-SAM and Sfmbt-SAM heterodimer
Class: nuclear protein
Keywords: PRC1 PhoRC SAM domain Polycom Response Element, Drosophila, signaling protein, nuclear protein
Deposited on 2016-04-08, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polycomb protein Scm
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Scm, CG9495
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-79)
      • expression tag (2-4)
      • conflict (57)
      • conflict (61)
    Domains in SCOPe 2.07: d5j8ya1, d5j8ya2
  • Chain 'B':
    Compound: Polycomb protein Scm
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Scm, CG9495
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-79)
      • expression tag (2-4)
      • conflict (57)
      • conflict (61)
    Domains in SCOPe 2.07: d5j8yb1, d5j8yb2
  • Chain 'C':
    Compound: Polycomb protein Sfmbt
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Sfmbt, CG16975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VK33 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5j8yc1, d5j8yc2
  • Chain 'D':
    Compound: Polycomb protein Sfmbt
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Sfmbt, CG16975
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VK33 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5j8yd1, d5j8yd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j8yA (A:)
    gpdsmpidwtieeviqyiesndnslavhgdlfrkheidgkallllnsemmmkymglkegp
    aekicnlvnkvngrrnnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8yA (A:)
    dsmpidwtieeviqyiesndnslavhgdlfrkheidgkallllnsemmmkymglkegpae
    kicnlvnkvngrrnnlal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j8yB (B:)
    gpdsmpidwtieeviqyiesndnslavhgdlfrkheidgkallllnsemmmkymglkegp
    aekicnlvnkvngrrnnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8yB (B:)
    dsmpidwtieeviqyiesndnslavhgdlfrkheidgkallllnsemmmkymglkegpae
    kicnlvnkvngrrnnlal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j8yC (C:)
    gpdsmpdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpal
    kisdliaqlkckvnpgrarshktnkspfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8yC (C:)
    mpdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpalkisd
    liaqlkckv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j8yD (D:)
    gpdsmpdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpal
    kisdliaqlkckvnpgrarshktnkspfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8yD (D:)
    mpdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpalkisd
    liaqlkckvn