PDB entry 5j8q

View 5j8q on RCSB PDB site
Description: Crystal Structure of the Cysteine Desulfurase SufS of Bacillus subtilis
Class: transferase
Keywords: Cysteine Desulfurase, Iron sulfur cluster, SUF-system, transferase
Deposited on 2016-04-08, released 2016-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase SufS
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufS, csd, yurW, BSU32690
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32164 (0-405)
      • expression tag (406-412)
    Domains in SCOPe 2.08: d5j8qa1, d5j8qa2
  • Heterogens: PLP, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j8qA (A:)
    mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
    tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
    hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
    ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
    lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
    rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
    caqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8qA (A:)
    mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
    tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
    hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
    ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
    lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
    rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
    caqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfsghhhhh