PDB entry 5j8j

View 5j8j on RCSB PDB site
Description: a histone deacetylase from saccharomyces cerevisiae
Deposited on 2016-04-07, released 2017-04-19
The last revision was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase HDA1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: HDA1, YNL021W, N2819
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53973 (9-250)
      • expression tag (2-8)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j8jA (A:)
    hhhhhhgsmlqkairqqqqhylsdefnfvtlplvsmdlpdntvlctpnisesntiiivvh
    dtsdiwakrnvisgtidlsssviidnsldfikwgldrkygiidvnipltlfepdnysgmi
    tsqevliylwdnyikyfpsvakiafigigdsysgivhllghrdtravtktvinflgdkql
    kplvplvdetlsewyfknslifsnnshqcwkenesrkprkkfgrvlrcdtdglnniieer
    feeatdfilds
    

    Sequence, based on observed residues (ATOM records):
    >5j8jA (A:)
    hhhhgsmlqkairqqqqhylsdefnfvtlplvsmdlpdntvlctpnisesntiiivvhdt
    sdiwakrnvisgtidlsssviidnsldfikwgldrkygiidvnipltlfepdnysgmits
    qevliylwdnyikyfpsvakiafigigdsysgivhllghrdtravtktvinflgdkqlkp
    lvplvdetlsewyfknslifsnnshqcwkkprkkfgrvlrcdtdglnniieerfeeatdf
    ilds