PDB entry 5j8c

View 5j8c on RCSB PDB site
Description: Human MOF C316S, E350Q crystal structure
Class: transferase
Keywords: acetyltransferase, MYST, GNAT, epigenetics, TRANSFERASE
Deposited on 2016-04-07, released 2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7Z6 (25-End)
      • expression tag (23-24)
      • engineered mutation (164)
      • engineered mutation (198)
    Domains in SCOPe 2.08: d5j8ca1, d5j8ca2
  • Heterogens: ZN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j8cA (A:)
    mgsshhhhhhdydipttenlyfqgskyvdkihignyeidawyfspfpedygkqpklwlce
    yclkymkyeksyrfhlgqcqwrqppgkeiyrksnisvyevdgkdhkiycqnlcllaklfl
    dhktlyfdvepfvfyiltevdrqgahivgyfskekespdgnnvasiltlppyqrrgygkf
    liafsyelsklestvgspqkplsdlgklsyrsywswvlleilrdfrgtlsikdlsqmtsi
    tqndiistlqslnmvkywkgqhvicvtpklveehlksaqykkppitvdsvclkwappkhk
    qvklskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j8cA (A:)
    gskyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrq
    ppgkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrq
    gahivgyfskekespdgnnvasiltlppyqrrgygkfliafsyelsklestvgspqkpls
    dlgklsyrsywswvlleilrdfgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvi
    cvtpklveehlksaqykkppitvdsvclkwap