PDB entry 5j85

View 5j85 on RCSB PDB site
Description: ser480ala mutant of l-arabinonate dehydratase
Deposited on 2016-04-07, released 2017-06-21
The last revision was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroxyacid dehydratase/phosphogluconate dehydratase
    Species: Rhizobium leguminosarum bv. trifolii [TaxId:386]
    Gene: Rleg9DRAFT_6269
    Database cross-references and differences (RAF-indexed):
    • Uniprot I9XDU6 (Start-587)
      • engineered mutation (488)
  • Heterogens: FES, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j85A (A:)
    mdwshpqfekkkkaewprklrsqewyggtsrdviyhrgwlknqgyphdlfdgrpvigiln
    twsdmtpcnghlrelaekvkagvweaggfplevpvfsasentfrptammyrnlaalavee
    airgqpmdgcvllvgcdkttpsllmgaascdlpsivvtggpmlngyfrgervgsgthlwk
    fsemvkagemtqaefleaeasmsrssgtcntmgtastmasmaealgmalsgnaaipgvds
    rrkvmaqltgrrivqmvkddlkpseimtkqafenairtnaaiggstnavihllaiagrvg
    idlslddwdrcgrdvptivnlmpsgkylmeeffyagglpvvlkrlgeagllhkdaltvsg
    etvwdevkdvvnwnedvilpaekaltssggivvlrgnlapkgavlkpsaasphllvhkgr
    avvfediddykakinddnldidencimvmkncgpkgypgmaevgnmglppkvlkkgildm
    vrisdarmagtaygtvvlhtspeaavggplavvkngdmieldvpnrrlhldisdeelarr
    laewqpnhdlptsgyaflhqqhvegadtgadldflkgcrgnavgkdsh
    

    Sequence, based on observed residues (ATOM records):
    >5j85A (A:)
    kaewprklrsqewyggtsrdviyhrgwlknqgyphdlfdgrpvigilntwsdmtpcnghl
    relaekvkagvweaggfplevpvfsasentfrptammyrnlaalaveeairgqpmdgcvl
    lvgcdkttpsllmgaascdlpsivvtggpmlngyfrgervgsgthlwkfsemvkagemtq
    aefleaeasmsrssgtcntmgtastmasmaealgmalsgnaaipgvdsrrkvmaqltgrr
    ivqmvkddlkpseimtkqafenairtnaaiggstnavihllaiagrvgidlslddwdrcg
    rdvptivnlmpsgkylmeeffyagglpvvlkrlgeagllhkdaltvsgetvwdevkdvvn
    wnedvilpaekaltssggivvlrgnlapkgavlkpsaasphllvhkgravvfediddyka
    kinddnldidencimvmkncgpkgypgmaevgnmglppkvlkkgildmvrisdarmagta
    ygtvvlhtspeaavggplavvkngdmieldvpnrrlhldisdeelarrlaewqpnhdlpt
    sgyaflhqqhvegadtgadldflkgcrgnavgkdsh