PDB entry 5j81

View 5j81 on RCSB PDB site
Description: crystal structure of glycoprotein c from puumala virus in the post- fusion conformation (ph 6.0)
Deposited on 2016-04-07, released 2016-10-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelopment polyprotein
    Species: Puumala virus (strain P360) [TaxId:39001]
    Gene: GP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: P33, SO4, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j81A (A:)
    etqnlnagwtdtahgsgiipmktdleldfslpssasytyrrqlqnpaneqekipfhlqls
    kqvihaeiqhlghwmdatfnlktafhcygscekyaypwqtagcfiekdyeyetgwgcnpp
    dcpgvgtgctacgvyldklksvgkvfkivslrytrkvciqlgteqtcktvdsndclitts
    vkvcligtiskfqpsdtllflgplqqgglifkqwctttcqfgdpgdimstptgmkcpeln
    gsfrkkcafattpvcqfdgntisgykrmiatkdsfqsfnvtephistsalewidpdsslr
    dhinvivsrdlsfqdlsetpcqidlatasidgawgsgvgfnlvctvsltecsafltsika
    cdaamcygsttanlvrgqntihivgkgghsgskfmcchdtkcsstglvaaaphldrvtgy
    nqadsdkifddgapecgmscwfkksgew
    

    Sequence, based on observed residues (ATOM records):
    >5j81A (A:)
    gwtdtahgsgiipmktdleldfslpssasytyrrqlqnpaneqekipfhlqlskqvihae
    iqhlghwmdatfnlktafhcygscekyaypwqtagcfiekdyeyetgwgcnppdcpgvgt
    gctacgvyldklksvgkvfkivslrytrkvciqlgteqtcktvdsndclittsvkvclig
    tiskfqpsdtllflgplqqgglifkqwctttcqfgdpgdimstptgmkcpelngsfrkkc
    afattpvcqfdgntisgykrmiatkdsfqsfnvtephistsalewidpdsslrdhinviv
    srdlsfqdlsetpcqidlatasidgawgsgvgfnlvctvsltecsafltsikacdaamcy
    gsttanlvrgqntihivgkgghsgskfmcchdtkcsstglvaaaphldrvt