PDB entry 5j7z

View 5j7z on RCSB PDB site
Description: crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm1
Deposited on 2016-04-07, released 2016-04-27
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative secreted endoglycosylceramidase
    Species: Rhodococcus equi 103S [TaxId:685727]
    Gene: REQ_38260
    Database cross-references and differences (RAF-indexed):
    • Uniprot E4W8N9
      • engineered mutation (346)
  • Chain 'B':
    Compound: Putative secreted endoglycosylceramidase
    Species: Rhodococcus equi 103S [TaxId:685727]
    Gene: REQ_38260
    Database cross-references and differences (RAF-indexed):
    • Uniprot E4W8N9
      • engineered mutation (346)
  • Heterogens: NA, 18C, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j7zA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsappatpittlqadgthlvdgygrtvl
    lhgvnnvdkdapylpagetltpqdidilvrhgfntvrlgtsfdalmpqrgqideayldrl
    tgvvdaltargmhvlldnhqdglskawggngfpewaiesrprewepnpgfplyylmpsln
    agwdevwgnthgaldhlgtalgalaervegkpgvmgiellnepwpgsrflscfpngcpdf
    drtyqaamqkltdavraqnptipvywepnvtwnqmmpsnlfappvtpalttadvvfaphd
    ycipsqlaiylglpqalrglcvpqqdltwsnidaiteranvptvitsfgdgdptvlkntl
    araderfigwqywhfgagnatdpflgevgrqlvrtypqatagepgrmifdadngdfayrf
    tpraatrpteifvsdlhypdgyavqvdggqvtsapgarivtvvadgsgpvtvkinrpgsa
    gaevpdgpietsssgssgss
    

    Sequence, based on observed residues (ATOM records):
    >5j7zA (A:)
    patpittlqadgthlvdgygrtvllhgvnnvdkdapylpagetltpqdidilvrhgfntv
    rlgtsfdalmpqrgqideayldrltgvvdaltargmhvlldnhqdglskawggngfpewa
    iesrprewepnpgfplyylmpslnagwdevwgnthgaldhlgtalgalaervegkpgvmg
    iellnepwpgsrflscfpngcpdfdrtyqaamqkltdavraqnptipvywepnvtwnqmm
    psnlfappvtpalttadvvfaphdycipsqlaiylglpqalrglcvpqqdltwsnidait
    eranvptvitsfgdgdptvlkntlaraderfigwqywhfgagnatdpflgevgrqlvrty
    pqatagepgrmifdadngdfayrftpraatrpteifvsdlhypdgyavqvdggqvtsapg
    arivtvvadgsgpvtvkinrpgsagaevpd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j7zB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsappatpittlqadgthlvdgygrtvl
    lhgvnnvdkdapylpagetltpqdidilvrhgfntvrlgtsfdalmpqrgqideayldrl
    tgvvdaltargmhvlldnhqdglskawggngfpewaiesrprewepnpgfplyylmpsln
    agwdevwgnthgaldhlgtalgalaervegkpgvmgiellnepwpgsrflscfpngcpdf
    drtyqaamqkltdavraqnptipvywepnvtwnqmmpsnlfappvtpalttadvvfaphd
    ycipsqlaiylglpqalrglcvpqqdltwsnidaiteranvptvitsfgdgdptvlkntl
    araderfigwqywhfgagnatdpflgevgrqlvrtypqatagepgrmifdadngdfayrf
    tpraatrpteifvsdlhypdgyavqvdggqvtsapgarivtvvadgsgpvtvkinrpgsa
    gaevpdgpietsssgssgss
    

    Sequence, based on observed residues (ATOM records):
    >5j7zB (B:)
    patpittlqadgthlvdgygrtvllhgvnnvdkdapylpagetltpqdidilvrhgfntv
    rlgtsfdalmpqrgqideayldrltgvvdaltargmhvlldnhqdglskawggngfpewa
    iesrprewepnpgfplyylmpslnagwdevwgnthgaldhlgtalgalaervegkpgvmg
    iellnepwpgsrflscfpngcpdfdrtyqaamqkltdavraqnptipvywepnvtwnqmm
    psnlfappvtpalttadvvfaphdycipsqlcvpqqdltwsnidaiteranvptvitsfg
    dgdptvlkntlaraderfigwqywhfgagnatdpflgevgrqlvrtypqatagepgrmif
    dadngdfayrftpraatrpteifvsdlhypdgyavqvdggqvtsapgarivtvvadgsgp
    vtvkinrpgsagaevp