PDB entry 5j7x

View 5j7x on RCSB PDB site
Description: baeyer-villiger monooxygenase bvmoafl838 from aspergillus flavus
Deposited on 2016-04-07, released 2016-08-10
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dimethylaniline monooxygenase, putative
    Species: Aspergillus flavus [TaxId:5059]
    Gene: AFLA_016370
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8N653 (Start-542)
      • expression tag (543-544)
  • Heterogens: FAD, SO4, TAM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j7xA (A:)
    mngtqasngvlhldaliigsgfsgiyllhklrdelklkvkifeaesdiggtwnnnrypga
    rvdcpvpfyayslpevwqswnwtelypnqkeiksyfdhvdrvldvrkdclfhsrvnegtf
    deatgrwtvwttdgkvatakyllvavgfasksylpdwkgldsfkgtiyhsahwpeaeeis
    vkgkkvavigtgstgiqifqewareaeeaflfqrtpnlclpmrqqelhagyqvkdkgeya
    dylaecaltfggleyqqtpkntfdaseeereafwedlyqmggfrfwqnnyqdlltsldan
    reaynfwarktrariqdpkkrdllapleppypfgtkrpsleqdfyeqfnksnvhivdtks
    qpivgvtptgivtadekvhevdiiavatgfdavtggllrlglkdvngvglderwkdgmst
    ylgmaisgfpnmflpyslqaptafangptlielqgdwitslirkmemenvqsvtatphae
    sawndevnmianktllpltdswymgsnipgkpvqslnylgglptyrercakvldedffgf
    akahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7xA (A:)
    gvlhldaliigsgfsgiyllhklrdelklkvkifeaesdiggtwnnnrypgarvdcpvpf
    yayslpevwqswnwtelypnqkeiksyfdhvdrvldvrkdclfhsrvnegtfdeatgrwt
    vwttdgkvatakyllvavgfasksylpdwkgldsfkgtiyhsahwpeaeeisvkgkkvav
    igtgstgiqifqewareaeeaflfqrtpnlclpmrqqelhaadylaecaltfggleyqqt
    pkntfdaseeereafwedlyqmggfrfwqnnyqdlltsldanreaynfwarktrariqdp
    kkrdllapleppypfgtkrpsleqdfyeqfnksnvhivdtksqpivgvtptgivtadekv
    hevdiiavatgfdavtggllrlglkdvngvglderwkdgmstylgmaisgfpnmflpysl
    qaptafangptlielqgdwitslirkmemenvqsvtatphaesawndevnmianktllpl
    tdswymgsnipgkpvqslnylgglptyrercakvldedffgfakahh