PDB entry 5j7m

View 5j7m on RCSB PDB site
Description: crystal structure of cupin 2 conserved barrel domain protein from kribbella flavida dsm 17836
Deposited on 2016-04-06, released 2016-04-27
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2 conserved barrel domain protein
    Species: Kribbella flavida [TaxId:479435]
    Gene: Kfla_2934
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2Q1L0 (3-122)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Cupin 2 conserved barrel domain protein
    Species: Kribbella flavida [TaxId:479435]
    Gene: Kfla_2934
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2Q1L0 (3-122)
      • expression tag (1-2)
  • Heterogens: EOH, NI, PEG, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j7mA (A:)
    snamrtfdlvtgeslfvndlrvvrweqyglgtampfqamwysvppgdespidqhpelels
    ivvagtahvtvgdtvhevphgnafllnsleahvvqnrsadevltvfsaywypeaataaae
    ala
    

    Sequence, based on observed residues (ATOM records):
    >5j7mA (A:)
    namrtfdlvtgeslfvndlrvvrweqyglgtampfqamwysvppgdespidqhpelelsi
    vvagtahvtvgdtvhevphgnafllnsleahvvqnrsadevltvfsaywypeaataaaea
    la
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j7mB (B:)
    snamrtfdlvtgeslfvndlrvvrweqyglgtampfqamwysvppgdespidqhpelels
    ivvagtahvtvgdtvhevphgnafllnsleahvvqnrsadevltvfsaywypeaataaae
    ala
    

    Sequence, based on observed residues (ATOM records):
    >5j7mB (B:)
    namrtfdlvtgeslfvndlrvvrweqyglgtampfqamwysvppgdespidqhpelelsi
    vvagtahvtvgdtvhevphgnafllnsleahvvqnrsadevltvfsaywypeaataaaea
    la