PDB entry 5j7k

View 5j7k on RCSB PDB site
Description: loop grafting onto a highly stable fn3 scaffold
Deposited on 2016-04-06, released 2016-08-17
The last revision was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K
  • Chain 'B':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K (Start-98)
  • Chain 'C':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K
  • Chain 'D':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K (Start-98)
  • Chain 'E':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K
  • Chain 'F':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K
  • Chain 'G':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K
  • Chain 'H':
    Compound: FN3con-a-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J7K (Start-98)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j7kA (A:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kA (A:)
    gnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtglkpgte
    yefrvravnrpssvsvttghhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j7kB (B:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kB (B:)
    ppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtglkpg
    teyefrvravnrvgrtfsvsvttghhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j7kC (C:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kC (C:)
    gnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvphrytvtglkpgteyefr
    vravnrsvsvttghhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j7kD (D:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kD (D:)
    lrvtdvtstsvtlswrveyrearytvtglkpgteyefrvravvsvttghhhhhh
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5j7kE (E:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kE (E:)
    nlrvtdvtstsvtlswypwatgyrveyreaewkevtvpgdlshrytvtglkpgteyefrv
    ravpssvsvttgh
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5j7kF (F:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kF (F:)
    nlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtglkpgtey
    efrvravssvsvttghhhh
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5j7kG (G:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kG (G:)
    nlrvtdvtstsvtlswrgypwatgyrveyreaggwkevtvpgdlshrytvtglkpgteye
    frvravnrvgrpssvsvttghhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5j7kH (H:)
    mpsppgnlrvtdvtstsvtlswrgypwatgyrveyreaggewkevtvpgdlshrytvtgl
    kpgteyefrvravnrvgrtfdtpgpssvsvttghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5j7kH (H:)
    nlrvtdvtstsvtlswryryrevtvpgdlshrytvtglkpgteyefrvrpssvsvttghh
    hhhh