PDB entry 5j7f

View 5j7f on RCSB PDB site
Description: Structure of MDM2 with low molecular weight inhibitor with aliphatic linker.
Class: ligase
Keywords: p53, MDM2, MDMX, protein-protein interaction, cancer, inhibitor, ligase
Deposited on 2016-04-06, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j7fa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j7fb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j7fc_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j7fd_
  • Heterogens: 6GG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j7fA (A:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
    svsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j7fA (A:)
    dgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydek
    qqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j7fB (B:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
    svsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j7fB (B:)
    gavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekq
    qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j7fC (C:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
    svsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j7fC (C:)
    dgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydek
    qqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j7fD (D:)
    mcntnmsvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqy
    imtkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgt
    svsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j7fD (D:)
    gavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekq
    qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv