PDB entry 5j7a

View 5j7a on RCSB PDB site
Description: Bacteriorhodopsin ground state structure obtained with Serial Femtosecond Crystallography
Class: proton transport
Keywords: light-driven proton pump, retinal binding, seven transmembrane helix protein, proton transport
Deposited on 2016-04-06, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) [TaxId:64091]
    Gene: bop, VNG_1467G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j7aa_
  • Heterogens: RET, LI1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j7aA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j7aA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffskaesmrpevastfkvlrnvtvvlwsaypv
    vwligsegagivplnietllfmvldvsakvgfglillrsraifg