PDB entry 5j78

View 5j78 on RCSB PDB site
Description: crystal structure of an acetylating aldehyde dehydrogenase from geobacillus thermoglucosidasius
Deposited on 2016-04-06, released 2016-09-07
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetaldehyde dehydrogenase (acetylating)
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Gene: AcAldDH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: acetaldehyde dehydrogenase (acetylating)
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Gene: AcAldDH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: acetaldehyde dehydrogenase (acetylating)
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Gene: AcAldDH
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: acetaldehyde dehydrogenase (acetylating)
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Gene: AcAldDH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j78A (A:)
    mgsshhhhhhssglvprgshmasmlrdidlqsiqevrnyleeakaaqkilekmtqseidk
    ivesmanaareeagrlaamaveetgfgnvedktlknlfaandvynsikdvktvgiirrde
    enrvweiaqpvgivagiipstnptstvifkaliavkarnaivfsphpsaakctaeaarim
    qeaaeragapkgliscitqptmaatnelmkhkltdvilatggpglvkaayssgkpaygvg
    pgnvpvyihesaniakavqliiqsktfdygticaseqallvdesikekvvaelkqqgayf
    lneeekqkvasiimvngslnakivgkapqviaemagieipsdvkllvaeetevgkeypfs
    ieklspilafyivkgmeeaselaqkllevgglghtvgihaedekvieaytidkpagrivv
    nagttfggigatvnvkpsltlgcgaignnitsdnvtvthlfnikrvafgvrempkkvega
    qkepaltk
    

    Sequence, based on observed residues (ATOM records):
    >5j78A (A:)
    lrdidlqsiqevrnyleeakaaqkilekmtqseidkivesmanaareeagrlaamaveet
    gfgnvedktlknlfaandvynsikdvktvgiirrdeenrvweiaqpvgivagiipstnpt
    stvifkaliavkarnaivfsphpsaakctaeaarimqeaaeragapkgliscitqptmaa
    tnelmkhkltdvilatggpglvkaayssgkpaygvgpgnvpvyihesaniakavqliiqs
    ktfdygticaseqallvdesikekvvaelkqqgayflneeekqkvasiimvngslnakiv
    gkapqviaemagieipsdvkllvaeetevgkeypfsieklspilafyivkgmeeaselaq
    kllevgglghtvgihaedekvieaytidkpagrivvnagttfggigatvnvkpsltlgcg
    aignnitsdnvtvthlfnikrvafgvrempkkv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j78B (B:)
    mgsshhhhhhssglvprgshmasmlrdidlqsiqevrnyleeakaaqkilekmtqseidk
    ivesmanaareeagrlaamaveetgfgnvedktlknlfaandvynsikdvktvgiirrde
    enrvweiaqpvgivagiipstnptstvifkaliavkarnaivfsphpsaakctaeaarim
    qeaaeragapkgliscitqptmaatnelmkhkltdvilatggpglvkaayssgkpaygvg
    pgnvpvyihesaniakavqliiqsktfdygticaseqallvdesikekvvaelkqqgayf
    lneeekqkvasiimvngslnakivgkapqviaemagieipsdvkllvaeetevgkeypfs
    ieklspilafyivkgmeeaselaqkllevgglghtvgihaedekvieaytidkpagrivv
    nagttfggigatvnvkpsltlgcgaignnitsdnvtvthlfnikrvafgvrempkkvega
    qkepaltk
    

    Sequence, based on observed residues (ATOM records):
    >5j78B (B:)
    lrdidlqsiqevrnyleeakaaqkilekmtqseidkivesmanaareeagrlaamaveet
    gfgnvedktlknlfaandvynsikdvktvgiirrdeenrvweiaqpvgivagiipstnpt
    stvifkaliavkarnaivfsphpsaakctaeaarimqeaaeragapkgliscitqptmaa
    tnelmkhkltdvilatggpglvkaayssgkpaygvgpgnvpvyihesaniakavqliiqs
    ktfdygticaseqallvdesikekvvaelkqqgayflneeekqkvasiimvngslnakiv
    gkapqviaemagieipsdvkllvaeetevgkeypfsieklspilafyivkgmeeaselaq
    kllevgglghtvgihaedekvieaytidkpagrivvnagttfggigatvnvkpsltlgcg
    aignnitsdnvtvthlfnikrvafgvrempkkv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j78C (C:)
    mgsshhhhhhssglvprgshmasmlrdidlqsiqevrnyleeakaaqkilekmtqseidk
    ivesmanaareeagrlaamaveetgfgnvedktlknlfaandvynsikdvktvgiirrde
    enrvweiaqpvgivagiipstnptstvifkaliavkarnaivfsphpsaakctaeaarim
    qeaaeragapkgliscitqptmaatnelmkhkltdvilatggpglvkaayssgkpaygvg
    pgnvpvyihesaniakavqliiqsktfdygticaseqallvdesikekvvaelkqqgayf
    lneeekqkvasiimvngslnakivgkapqviaemagieipsdvkllvaeetevgkeypfs
    ieklspilafyivkgmeeaselaqkllevgglghtvgihaedekvieaytidkpagrivv
    nagttfggigatvnvkpsltlgcgaignnitsdnvtvthlfnikrvafgvrempkkvega
    qkepaltk
    

    Sequence, based on observed residues (ATOM records):
    >5j78C (C:)
    lrdidlqsiqevrnyleeakaaqkilekmtqseidkivesmanaareeagrlaamaveet
    gfgnvedktlknlfaandvynsikdvktvgiirrdeenrvweiaqpvgivagiipstnpt
    stvifkaliavkarnaivfsphpsaakctaeaarimqeaaeragapkgliscitqptmaa
    tnelmkhkltdvilatggpglvkaayssgkpaygvgpgnvpvyihesaniakavqliiqs
    ktfdygticaseqallvdesikekvvaelkqqgayflneeekqkvasiimvngslnakiv
    gkapqviaemagieipsdvkllvaeetevgkeypfsieklspilafyivkgmeeaselaq
    kllevgglghtvgihaedekvieaytidkpagrivvnagttfggigatvnvkpsltlgcg
    aignnitsdnvtvthlfnikrvafgvrempkkv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j78D (D:)
    mgsshhhhhhssglvprgshmasmlrdidlqsiqevrnyleeakaaqkilekmtqseidk
    ivesmanaareeagrlaamaveetgfgnvedktlknlfaandvynsikdvktvgiirrde
    enrvweiaqpvgivagiipstnptstvifkaliavkarnaivfsphpsaakctaeaarim
    qeaaeragapkgliscitqptmaatnelmkhkltdvilatggpglvkaayssgkpaygvg
    pgnvpvyihesaniakavqliiqsktfdygticaseqallvdesikekvvaelkqqgayf
    lneeekqkvasiimvngslnakivgkapqviaemagieipsdvkllvaeetevgkeypfs
    ieklspilafyivkgmeeaselaqkllevgglghtvgihaedekvieaytidkpagrivv
    nagttfggigatvnvkpsltlgcgaignnitsdnvtvthlfnikrvafgvrempkkvega
    qkepaltk
    

    Sequence, based on observed residues (ATOM records):
    >5j78D (D:)
    lrdidlqsiqevrnyleeakaaqkilekmtqseidkivesmanaareeagrlaamaveet
    gfgnvedktlknlfaandvynsikdvktvgiirrdeenrvweiaqpvgivagiipstnpt
    stvifkaliavkarnaivfsphpsaakctaeaarimqeaaeragapkgliscitqptmaa
    tnelmkhkltdvilatggpglvkaayssgkpaygvgpgnvpvyihesaniakavqliiqs
    ktfdygticaseqallvdesikekvvaelkqqgayflneeekqkvasiimvngslnakiv
    gkapqviaemagieipsdvkllvaeetevgkeypfsieklspilafyivkgmeeaselaq
    kllevgglghtvgihaedekvieaytidkpagrivvnagttfggigatvnvkpsltlgcg
    aignnitsdnvtvthlfnikrvafgvrempkk