PDB entry 5j74

View 5j74 on RCSB PDB site
Description: Fluorogen activating protein AM2.2 in complex with TO1-2p
Class: immune system
Keywords: fluorogen activating protein drug discovery biosensor protein trafficking, PROTEIN BINDING, IMMUNE SYSTEM
Deposited on 2016-04-05, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scFv AM2.2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J74
    Domains in SCOPe 2.08: d5j74a1, d5j74a2
  • Chain 'B':
    Compound: scFv AM2.2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5J74
    Domains in SCOPe 2.08: d5j74b1, d5j74b2
  • Heterogens: PO4, 6GN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j74A (A:)
    qvqlveseaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggtipifgtady
    aqefqgrvtittdeststaymelsglrsedtavyycvllgttmvtghyfdywgqgtlvtv
    ssgilgsggggsggggsggggsnfmltqppsasgtpgqsvtiscsgsgsnignnkvnwyq
    qlpgtapklliysnnqrpsgvpdrfsgsksgtsaslaisglqsedeadyycaawddglsg
    yvfgtgtkltvlaasgadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j74A (A:)
    vqlveseaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggtipifgtadya
    qefqgrvtittdeststaymelsglrsedtavyycvllgttmvtghyfdywgqgtlvtvn
    fmltqppsasgtpgqsvtiscsgsgsnignnkvnwyqqlpgtapklliysnnqrpsgvpd
    rfsgsksgtsaslaisglqsedeadyycaawddglsgyvfgtgtkltvlaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j74B (B:)
    qvqlveseaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggtipifgtady
    aqefqgrvtittdeststaymelsglrsedtavyycvllgttmvtghyfdywgqgtlvtv
    ssgilgsggggsggggsggggsnfmltqppsasgtpgqsvtiscsgsgsnignnkvnwyq
    qlpgtapklliysnnqrpsgvpdrfsgsksgtsaslaisglqsedeadyycaawddglsg
    yvfgtgtkltvlaasgadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j74B (B:)
    vqlveseaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggtipifgtadya
    qefqgrvtittdeststaymelsglrsedtavyycvllgttmvtghyfdywgqgtlvtvs
    nfmltqppsasgtpgqsvtiscsgsgsnignnkvnwyqqlpgtapklliysnnqrpsgvp
    drfsgsksgtsaslaisglqsedeadyycaawddglsgyvfgtgtkltvlaas