PDB entry 5j6r

View 5j6r on RCSB PDB site
Description: crystal structure of human papillomavirus type 59 l1 pentamer
Deposited on 2016-04-05, released 2016-05-18
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 4.01 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'B':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'D':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'E':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'F':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'G':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'H':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)
  • Chain 'J':
    Compound: Major capsid protein L1
    Species: Human papillomavirus type 59 [TaxId:37115]
    Gene: ORF putative L1, L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81971
      • engineered mutation (166)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j6rA (A:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rA (A:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j6rB (B:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rB (B:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtatvvqgdcpplelintpiedgdmvdt
    gygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarhfwnr
    sgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqglnngi
    cwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifqlckit
    lttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j6rC (C:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rC (C:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j6rD (D:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rD (D:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5j6rE (E:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rE (E:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5j6rF (F:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rF (F:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5j6rG (G:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rG (G:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5j6rH (H:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rH (H:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtvvqgdcpplelintpiedgdmvdtgy
    gamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarhfwnrsg
    tmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqglnngicw
    hnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifqlckitlt
    tevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5j6rI (I:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rI (I:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5j6rJ (J:)
    mkvylpppsvakvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsay
    qyrvfrvklpdpnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynkldd
    tenshvasavdtkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcppl
    elintpiedgdmvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmff
    clrreqvfarhfwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfn
    kpywlhkaqglnngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhv
    eefdlqfifqlckitlttevmsyihnmnttiledwnfgvtppptaslvdtyrfvqsaavt
    cqkdtappvkqdpydklkfwpvdlkerfsadldqfplgrkfllqlgarpkptigprkraa
    paptstpspkrvkrrkssrk
    

    Sequence, based on observed residues (ATOM records):
    >5j6rJ (J:)
    kvvstdeyvtrtsifyhagssrlltvghpyfkvpkggngrqdvpkvsayqyrvfrvklpd
    pnkfglpdntvydpnsqrlvwacvgveigrgqplgvglsghplynklddtenshvasavd
    tkdtrdnvsvdykqtqlciigcvpaigehwtkgtaskpttvvqgdcpplelintpiedgd
    mvdtgygamdfkllqdnksevpldicqsickypdylqmsadaygdsmffclrreqvfarh
    fwnrsgtmgdqlpeslyikgtdiranpgsylyspspsgsvvtsdsqlfnkpywlhkaqgl
    nngicwhnqlfltvvdttrstnlsvcasttssipnvytptsfkeyarhveefdlqfifql
    ckitlttevmsyihnmnttiledwnqdpydklkfwpvdlkerfsadldqfplgrkfllql