PDB entry 5j6d

View 5j6d on RCSB PDB site
Description: Discovery of acyl guanidine tryptophan hydroxylase-1 inhibitors
Class: oxidoreductase/inhibitor
Keywords: TPH1, Iron, acyl, quanidine, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2016-04-04, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan 5-hydroxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPH1, TPH, TPRH, TRPH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j6da_
  • Chain 'B':
    Compound: Tryptophan 5-hydroxylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TPH1, TPH, TPRH, TRPH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j6db_
  • Heterogens: FE, TRS, GOL, 6H5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j6dA (A:)
    metvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpi
    pkvefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnfl
    kertgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpll
    aepsfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssisel
    khalsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftktikrpfgvky
    nhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6dA (A:)
    metvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpi
    pkvefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnfl
    kertgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpll
    aepsfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssisel
    khalsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftkti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j6dB (B:)
    metvpwfpkkisdldhcanrvlmygseldadhpgfkdnvyrkrrkyfadlamnykhgdpi
    pkvefteeeiktwgtvfqelnklypthacreylknlpllskycgyrednipqledvsnfl
    kertgfsirpvagylsprdflsglafrvfhctqyvrhssdpfytpepdtchellghvpll
    aepsfaqfsqeiglaslgaseeavqklatcyfftvefglckqdgqlrvfgagllssisel
    khalsghakvkpfdpkitckqeclittfqdvyfvsesfedakekmreftktikrpfgvky
    nhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6dB (B:)
    metvpwfpkkisdldhcanrvlmygselddnvyrkrrkyfadlamnykhpipkvktwgtv
    fqelnklypthacreylknlpllledvsnflkertgfsirpvagylsprdflsglafrvf
    hctqyvrhssdpfytpepdtchellghvpllaepsfaqfsqeiglaslgaseeavqklat
    cyfftvefglcrvfgagllssiselkhalskvkpfdpkitckqeclittfqdvyffedak
    ekmreftk