PDB entry 5j69

View 5j69 on RCSB PDB site
Description: structure of astrotactin-2, a conserved vertebrate-specific and perforin-like membrane protein involved in neuronal development
Deposited on 2016-04-04, released 2016-05-25
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.63 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Astrotactin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ASTN2, KIAA0634
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Astrotactin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ASTN2, KIAA0634
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j69A (A:)
    kfndtlfgemlhgynnrtqhvnqgqvfqmtfrennfikdfpqladgllviplpveeqcrg
    vlseplpdlqlltgdirydeamgypmvqqwrvrsnlyrvklstitlaagftnvlkiltke
    ssreellsfiqhygshyiaealygseltciihfpskkvqqqlwlqyqkettelgskkelk
    smpfitylsglltaqmlsddqlisgveirceekgrcpstchlcrrpgkeqlsptpvllei
    nrvvplytliqdngtkeafksalmss
    

    Sequence, based on observed residues (ATOM records):
    >5j69A (A:)
    fndtlfgemlhgynnrtqhvnqgqvfqmtfrennfikdfpqladgllviplpveeqcrgv
    lseplpdlqlltrydeamgypmvqqwrvrsnlyrvklstitlaagftnvlkiltkessre
    ellsfiqhygshyiaealygseltciihfpskkvqqqlwlqyqkettsmpfitylsgllt
    aqmlsdsgveirceekgrcpstchlcrrpkeqlsptpvlleinrvvplytliqdngtkea
    fksalmss
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j69B (B:)
    kfndtlfgemlhgynnrtqhvnqgqvfqmtfrennfikdfpqladgllviplpveeqcrg
    vlseplpdlqlltgdirydeamgypmvqqwrvrsnlyrvklstitlaagftnvlkiltke
    ssreellsfiqhygshyiaealygseltciihfpskkvqqqlwlqyqkettelgskkelk
    smpfitylsglltaqmlsddqlisgveirceekgrcpstchlcrrpgkeqlsptpvllei
    nrvvplytliqdngtkeafksalmss
    

    Sequence, based on observed residues (ATOM records):
    >5j69B (B:)
    ndtlfgemlhgynnrtqhvnqgqvfqmtfrennfikdfpqladgllviplpveeqcrgvl
    seplpdlqlltgdirydeamgypmvqqwrvrsnlyrvklstitlaagftnvlkiltkess
    reellsfiqhygshyiaealygseltciihfpskkvqqqlwlqyqkettsmpfitylsgl
    ltaqmlsddqlisgveirceekgrcpstchlcrrpgkeqlsptpvlleinrvvplytliq
    dngtkeafksalmss