PDB entry 5j60

View 5j60 on RCSB PDB site
Description: structure of a thioredoxin reductase from gloeobacter violaceus
Deposited on 2016-04-04, released 2016-07-27
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase
    Species: Gloeobacter violaceus (strain PCC 7421) [TaxId:251221]
    Gene: glr0719
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NMP6 (3-319)
      • expression tag (0-2)
  • Chain 'B':
    Compound: thioredoxin reductase
    Species: Gloeobacter violaceus (strain PCC 7421) [TaxId:251221]
    Gene: glr0719
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NMP6 (3-319)
      • expression tag (1-2)
  • Chain 'C':
    Compound: thioredoxin reductase
    Species: Gloeobacter violaceus (strain PCC 7421) [TaxId:251221]
    Gene: glr0719
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: thioredoxin reductase
    Species: Gloeobacter violaceus (strain PCC 7421) [TaxId:251221]
    Gene: glr0719
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, CA, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j60A (A:)
    gshmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpg
    emsgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgr
    iasipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpk
    dphtldghadellahpsvklwektrlirikgeeagvtavevrhpgesdsqellaegvfvy
    lqgskpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgcia
    amaidrflnsrkaikpdwah
    

    Sequence, based on observed residues (ATOM records):
    >5j60A (A:)
    gshmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpg
    emsgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgr
    iasipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpk
    dphtghadellahpsvklwektrlirikgeeagvtavevrhesdsqellaegvfvylqgs
    kpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgciaamai
    drflnsrkaikpdwah
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j60B (B:)
    gshmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpg
    emsgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgr
    iasipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpk
    dphtldghadellahpsvklwektrlirikgeeagvtavevrhpgesdsqellaegvfvy
    lqgskpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgcia
    amaidrflnsrkaikpdwah
    

    Sequence, based on observed residues (ATOM records):
    >5j60B (B:)
    shmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpge
    msgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgri
    asipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpkd
    phtghadellahpsvklwektrlirikgeeagvtavevrhpesdsqellaegvfvylqgs
    kpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgciaamai
    drflnsrkaikpdwah
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j60C (C:)
    gshmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpg
    emsgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgr
    iasipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpk
    dphtldghadellahpsvklwektrlirikgeeagvtavevrhpgesdsqellaegvfvy
    lqgskpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgcia
    amaidrflnsrkaikpdwah
    

    Sequence, based on observed residues (ATOM records):
    >5j60C (C:)
    eqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpgemsg
    dhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgriapg
    eaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpkdphhad
    ellahpsvklwektrlirikgeeavtavllaegvfvylqgskpitdfvagqvemkpdggv
    wvdemmqtsvpgvwgigdirntpfkqavvaagdgciaamaidrflnsrkaikpdwa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j60D (D:)
    gshmeqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpg
    emsgdhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgr
    iasipgeaeylgrgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpk
    dphtldghadellahpsvklwektrlirikgeeagvtavevrhpgesdsqellaegvfvy
    lqgskpitdfvagqvemkpdggvwvdemmqtsvpgvwgigdirntpfkqavvaagdgcia
    amaidrflnsrkaikpdwah
    

    Sequence, based on observed residues (ATOM records):
    >5j60D (D:)
    eqfdfdvvivgggpagctcalytarselktvildknpaagalaithkianypgvpgemsg
    dhllevmrdqavefgtvyrraqvygldlsepvkkvytpegiftgralvlatgamgriasi
    pgeaeylgvsycatcdgafyrnrevvvvglnpeaveeaqvltkfastvhwitpkdphhad
    ellahpsvklwektrliriktavevsqellaegvfvylqgskpitdfvagqvemkpdggv
    wvdemmqtsvpgvwgigdirntpfkqavvaagdgciaamaidrflnsrkaikpdwah