PDB entry 5j53

View 5j53 on RCSB PDB site
Description: the structure and mechanism of nov1, a resveratrol-cleaving dioxygenase
Deposited on 2016-04-01, released 2016-11-30
The last revision was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carotenoid oxygenase
    Species: Novosphingobium aromaticivorans (strain DSM 12444 / F199) [TaxId:279238]
    Gene: Saro_0802
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, OXY, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j53A (A:)
    maqfpntpsftgfntpsrieadiadlahegtipqglngafyrvqpdpqfpprldddiafn
    gdgmitrfhihdgqvdfrqrwaktdkwklenaagkalfgayrnpltddeavkgeirstan
    tnafvfggklwamkedspalvmdpatmetfgfekfggkmtgqtftahpkvdpktgnmvai
    gyaasglctddvtymevspegelvrevwfkvpyycmmhdfgitedylvlhivpsigswer
    leqgkphfgfdttmpvhlgiiprrdgvrqedirwftrdncfashvlnawqegtkihfvtc
    eaknnmfpffpdvhgapfngmeamshptdwvvdmasngedfagivklsdtaaefpriddr
    ftgqktrhgwflemdmkrpvelrggsaggllmnclfhkdfetgreqhwwcgpvsslqepc
    fvprakdapegdgwivqvcnrleeqrsdllifdaldiekgpvatvnipirlrfglhgnwa
    nadeiglaekvlaa
    

    Sequence, based on observed residues (ATOM records):
    >5j53A (A:)
    aqfpntpsftgfntpsrieadiadlahegtipqglngafyrvqpdpqfpprldddiafng
    dgmitrfhihdgqvdfrqrwaktdkwklenaagkalfgayrnpltddeavkgeirstant
    nafvfggklwamkedspalvmdpatmetfgfekfggkmtgqtftahpkvdpktgnmvaig
    yaasglctddvtymevspegelvrevwfkvpyycmmhdfgitedylvlhivpsigswerl
    eqgkphfgfdttmpvhlgiiprrdgvrqedirwftrdncfashvlnawqegtkihfvtce
    aknnmfpffpdvhgapfngmeamshptdwvvdmasngedfagivklsdtaaefpriddrf
    tgqktrhgwflemdmkrpvellmnclfhkdfetgreqhwwcgpvsslqepcfvprakdap
    egdgwivqvcnrleeqrsdllifdaldiekgpvatvnipirlrfglhgnwanadeigla