PDB entry 5j4v

View 5j4v on RCSB PDB site
Description: The crystal structure of Inhibitor Bound to JCV Helicase
Class: hydrolase/inhibitor
Keywords: Helicase, hexamer, Zn, ATP, HYDROLASE-INHIBITOR complex
Deposited on 2016-04-01, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03072 (Start-371)
      • engineered mutation (23)
      • engineered mutation (38)
      • engineered mutation (42)
      • engineered mutation (44-45)
      • engineered mutation (47-48)
      • engineered mutation (50-52)
      • engineered mutation (97)
      • engineered mutation (151)
      • engineered mutation (367)
    Domains in SCOPe 2.07: d5j4va_
  • Heterogens: ZN, MES, SO4, 6JH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j4vA (A:)
    gshmeepeetkqvswklvtqyaldtkcedvfllmgmylnfqeapaacaacaaadqpnhfn
    hhekhyynaqifadsknqksicqqavdtvaakqrvdslhmtreemlverfnflldkmdli
    fgahgnavleqymagvawihcllpqmdtviyeflkcivlnipkkrywlfkgpidsgkttl
    aaalldlcggkslnvnmplerlnfelgvgidqfmvvfedvkgtgaesrdlpsghgisnld
    clrdyldgsvkvnlerkhqnkrtqvfppgivtmneysvprtlqarfvrqidfrpkaylrk
    slscseyllekrilqsgmtllllliwfrpvadfaaaiherivqwkerldleismytfstm
    kanvgmgapild
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j4vA (A:)
    tkqvswklvtqyaldtkcedvfllmgmylnfqeapaacaacaaadqpnhfnhhekhyyna
    qifadsknqksicqqavdtvaakqrvdslhmtreemlverfnflldkmdlifgahgnavl
    eqymagvawihcllpqmdtviyeflkcivlnipkkrywlfkgpidsgkttlaaalldlcg
    gkslnvnmplerlnfelgvgidqfmvvfedvkgtgaesrdlpsghgisnldclrdyldgs
    vkvnlerrtqvfppgivtmneysvprtlqarfvrqidfrpkaylrkslscseyllekril
    qsgmtllllliwfrpvadfaaaiherivqwkerldleismytfstmkanvgmgapild