PDB entry 5j4u

View 5j4u on RCSB PDB site
Description: Crystal structure of a glutathione S-transferase PtGSTU30 from Populus trichocarpa in complex with GSH
Class: transferase
Keywords: GST, Complex, GSH, TRANSFERASE
Deposited on 2016-04-01, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione transferase family protein
    Species: POPULUS TRICHOCARPA [TaxId:3694]
    Gene: POPTR_0011s14410g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j4ua1, d5j4ua2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j4uA (A:)
    mhhhhhhgsefmasdqvtlldfwpspfgmrvrlalaekgvkyeyseedlrnksalllqmn
    pvnkqipvlvhngkpvcesliivqyidevwkdsapllpsdpyqraqsrfwadfvdkkiyd
    lgrkiwtkkgeeqeaakkdfidslklmegelgdkpyfggetigyvdialvpfyswfyaye
    tignfnieaecpkmiayckrclqketvskaledpqkvydfvlmlmkkfgie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j4uA (A:)
    sdqvtlldfwpspfgmrvrlalaekgvkyeyseedlrnksalllqmnpvnkqipvlvhng
    kpvcesliivqyidevwkdsapllpsdpyqraqsrfwadfvdkkiydlgrkiwtkkgeeq
    eaakkdfidslklmegelgdkpyfggetigyvdialvpfyswfyayetignfnieaecpk
    miayckrclqketvskaledpqkvydfvlmlmkkfgie