PDB entry 5j4h

View 5j4h on RCSB PDB site
Description: structure of humanised rada-mutant humrada22f in complex with indole- 6-carboxylic acid
Deposited on 2016-04-01, released 2016-10-19
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: radA, PF1926
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74036 (1-230)
      • engineered mutation (61-63)
      • engineered mutation (75)
      • engineered mutation (91-95)
      • engineered mutation (114)
  • Heterogens: 1F1, NA, CA, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j4hA (A:)
    matigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglng
    samyidtentfrperlreiaqnrgldpdevldnvayarafnsnhqmllvqqaedmikell
    ntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvq
    angghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records):
    >5j4hA (A:)
    atigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngs
    amyidtentfrperlreiaqnrgldpdevldnvayarafnsnhqmllvqqaedmikelln
    tdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvhi
    lahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied