PDB entry 5j48

View 5j48 on RCSB PDB site
Description: PKG I's Carboyl Terminal Cyclic Nucleotide Binding Domain (CNB-B) in a complex with 8-pCPT-cGMP
Class: protein binding
Keywords: Binding Sites, Cyclic AMP, Cyclic GMP, Cyclic GMP-Dependent Protein Kinase Type II, Mutagenesis, Site-Directed, Protein Binding, analogs
Deposited on 2016-03-31, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13976 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5j48a1, d5j48a2
  • Chain 'B':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13976 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5j48b1, d5j48b2
  • Heterogens: EDO, 6FW, NA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j48A (A:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j48A (A:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtreddpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhli
    gglddvsnkay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j48B (B:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j48B (B:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khliggl