PDB entry 5j45

View 5j45 on RCSB PDB site
Description: crystal structure of shrub, fly ortholog of snf7/chmp4b
Deposited on 2016-03-31, released 2016-07-20
The last revision was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GH13992p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: shrb, Vps32, CG8055, Dmel_CG8055
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j45A (A:)
    stgeaiqklretenmlikkqefleakiedelniarknasknkrvalqalkkkkrlekqlq
    qidgtlstiemqrealesantntavlttmknaadalkrahqnmdvdkvhdmmddiaeqqd
    vareisd
    

    Sequence, based on observed residues (ATOM records):
    >5j45A (A:)
    tgeaiqklretenmlikkqefleakiedelniarknasknkrvalqalkkkkrlekqlqq
    idgtlstiemqrealesantntavlttmknaadalkrahqnmdvdkvhdmmd