PDB entry 5j3s

View 5j3s on RCSB PDB site
Description: crystal structure of the catalytic domain of human tyrosyl dna phosphodiesterase 2 in complex with a small molecule inhibitor
Deposited on 2016-03-31, released 2016-05-04
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-DNA phosphodiesterase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TDP2, EAP2, TTRAP, AD-022
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95551 (3-End)
      • expression tag (2)
      • engineered mutation (163)
  • Heterogens: 6FQ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j3sA (A:)
    gshmfslitwnidgldlnnlserargvcsylalyspdviflqevippyysylkkrssnye
    iitgheegyftaimlkksrvklksqeiipfpstkmmrnllcvhvnvsgnelclmtshles
    trghaaermnqlkmvlkkmqeapesatvifagdtnlrdrevtrsgglpnnivdvweflgk
    pkhcqytwdtqmnsnlgitaacklrfdriffraaaeeghiiprsldllglekldcgrfps
    dhwgllcnldiil
    

    Sequence, based on observed residues (ATOM records):
    >5j3sA (A:)
    hmfslitwnidgldlnnlserargvcsylalyspdviflqevippyysylkkrssnyeii
    tgheegyftaimlkksrvklksqeiipfpstkmmrnllcvhvnvsgnelclmtshlestr
    ghaaermnqlkmvlkkmqeavifagdtnlrdrevtrsgglpnnivdvweflgkpkhcqyt
    wdtqmnsnlgitaacklrfdriffriiprsldllglekldcgrfpsdhwgllcnld