PDB entry 5j33

View 5j33 on RCSB PDB site
Description: isopropylmalate dehydrogenase in complex with nad+
Deposited on 2016-03-30, released 2016-05-18
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 3.49 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 3-isopropylmalate dehydrogenase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: IMDH2, IMDH, At1g80560, T21F11.11
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, SO4, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j33A (A:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33A (A:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvdsq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j33B (B:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33B (B:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5j33C (C:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33C (C:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5j33D (D:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33D (D:)
    rytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeetis
    aakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlk
    revaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafetar
    krrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtiv
    tnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatils
    aamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5j33E (E:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33E (E:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5j33F (F:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33F (F:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5j33G (G:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33G (G:)
    krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
    saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
    krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
    rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
    vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
    saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvds
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5j33H (H:)
    maaalqtnirtvkvpatfravskqslapfrvrcavaspgkkrytitllpgdgigpevvsi
    aknvlqqagslegvefnfrempiggaaldlvgvplpeetisaakesdavllgaiggykwd
    nnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkrevaegvdlmvvreltggi
    yfgeprgiktnengeevgfntevyaaheidriarvafetarkrrgklcsvdkanvleasi
    lwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtnnifgdilsdeasmitgs
    igmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaamllkyglgeekaakrie
    davlvalnngfrtgdiysagtklvgckemgeevlksvdsqvpasv
    

    Sequence, based on observed residues (ATOM records):
    >5j33H (H:)
    titllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeetisaa
    kesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastlkre
    vaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafetarkr
    rgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdtivtn
    nifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatilsaa
    mllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvd