PDB entry 5j2s

View 5j2s on RCSB PDB site
Description: NKR-P1B from Rattus norvegicus
Class: immune system
Keywords: immune receptor, signaling protein, immune system
Deposited on 2016-03-30, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Klrb1b, Nkrp1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j2sa_
  • Chain 'B':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Klrb1b, Nkrp1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j2sb_
  • Heterogens: NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j2sA (A:)
    gtgvqenrtkttdspaklkcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqd
    qeelrflrnltkrisssfwiglsytlsdekwkwingstlnsdalnitgdtekdscasvsq
    dkvlsescdsdniwicqxelkrestcnds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j2sA (A:)
    kcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqdqeelrflrnltkrisssf
    wiglsytlsdekwkwingstlnsdalnitgdtekdscasvsqdkvlsescdsdniwicqx
    el
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j2sB (B:)
    gtgvqenrtkttdspaklkcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqd
    qeelrflrnltkrisssfwiglsytlsdekwkwingstlnsdalnitgdtekdscasvsq
    dkvlsescdsdniwicqxelkrestcnds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j2sB (B:)
    kcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqdqeelrflrnltkrisssf
    wiglsytlsdekwkwingstlnsdalnitgdtekdscasvsqdkvlsescdsdniwicqx
    el