PDB entry 5j2q

View 5j2q on RCSB PDB site
Description: hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Deposited on 2016-03-29, released 2016-08-03
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 reverse transcriptase p66 subunit
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) [TaxId:11706]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-End)
      • engineered mutation (257)
      • engineered mutation (279)
  • Chain 'B':
    Compound: hiv-1 reverse transcriptase p51 domain
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) [TaxId:11706]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585
      • engineered mutation (279)
  • Chain 'P':
    Compound: DNA (5'-d(*ap*cp*ap*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*gp*(mrg)p*cp*gp*cp*cp*(6fm)p*(6fm))-3')
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  • Chain 'T':
    Compound: DNA (27-mer)
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  • Heterogens: MG, 6FM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j2qA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records):
    >5j2qA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
    dleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekds
    wtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilk
    epvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqltea
    vqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlek
    epivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqdsgl
    evnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvdkl
    vsagirk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j2qB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records):
    >5j2qB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdphpaglkkkksvtvldvgdayfsvpldedfrkytaft
    ipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
    dleigqhrtkieelrqhllrwgelhpdkwtvqpivlpekdswtvndiqklvgklnwasqi
    ypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaeiq
    kqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpkfk
    lpiqketwetwwteywqatwipewefvntpplvklwyqle
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.