PDB entry 5j1f

View 5j1f on RCSB PDB site
Description: structure of the spectrin repeats 5 and 6 of the plakin domain of plectin
Deposited on 2016-03-29, released 2016-07-20
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plectin,Plectin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEC, PLEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15149 (4-72)
      • expression tag (0-3)
      • engineered mutation (6)
      • linker (73-75)
    • Uniprot Q15149 (76-End)
  • Chain 'B':
    Compound: Plectin,Plectin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEC, PLEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15149 (4-72)
      • expression tag (1-3)
      • engineered mutation (6)
      • linker (73-75)
    • Uniprot Q15149 (76-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5j1fA (A:)
    gshmayaqffsdvreaegqlqklqealrrkyscdrsatvtrledllqdaqdekeqlneyk
    ghlsglakrakavgsgnqeaqeavtrleaqhqalvtlwhqlhvdmksllawqslrrdvql
    irswslatfrtlkpeeqrqalhslelhyqaflrdsqdaggfgpedrlmaereygscshhy
    qqllqsleqgaqee
    

    Sequence, based on observed residues (ATOM records):
    >5j1fA (A:)
    gshmayaqffsdvreaegqlqklqealrrkyscdrsatvtrledllqdaqdekeqlneyk
    ghlsglakrakavgsgnqeaqeavtrleaqhqalvtlwhqlhvdmksllawqslrrdvql
    irswslatfrtlkpeeqrqalhslelhyqaflrdsqdaggfgpedrlmaereygscshhy
    qqllqsle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5j1fB (B:)
    gshmayaqffsdvreaegqlqklqealrrkyscdrsatvtrledllqdaqdekeqlneyk
    ghlsglakrakavgsgnqeaqeavtrleaqhqalvtlwhqlhvdmksllawqslrrdvql
    irswslatfrtlkpeeqrqalhslelhyqaflrdsqdaggfgpedrlmaereygscshhy
    qqllqsleqgaqee
    

    Sequence, based on observed residues (ATOM records):
    >5j1fB (B:)
    shmayaqffsdvreaegqlqklqealrrkyscdrsatvtrledllqdaqdekeqlneykg
    hlsglakrakavgsgnqeaqeavtrleaqhqalvtlwhqlhvdmksllawqslrrdvqli
    rswslatfrtlkpeeqrqalhslelhyqaflrdsqdaggfgpedrlmaereygscshhyq
    qllqsleq