PDB entry 5j1e

View 5j1e on RCSB PDB site
Description: Crystal Structure of a Hydroxypyridone Carboxylic Acid Active-Site RNase H Inhibitor in Complex with HIV Reverse Transcriptase
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-03-29, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 reverse transcriptase p66 domain
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366
      • engineered mutation (281)
    Domains in SCOPe 2.07: d5j1ea1, d5j1ea2
  • Chain 'B':
    Compound: hiv-1 reverse transcriptase p51 domain
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (1-End)
      • expression tag (0)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d5j1eb1, d5j1eb2
  • Chain 'C':
    Compound: hiv-1 reverse transcriptase p66 domain
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366
      • engineered mutation (281)
    Domains in SCOPe 2.07: d5j1ec1, d5j1ec2
  • Chain 'D':
    Compound: hiv-1 reverse transcriptase p51 domain
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate BH10) [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366
      • engineered mutation (280)
    Domains in SCOPe 2.07: d5j1ed_
  • Heterogens: MG, 6FT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j1eA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdi
    viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j1eA (A:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddlyv
    gsdleigqhrtkieelrqhllrwglttpdqkeppflwmgyelhpdkwtvqpivlpekdsw
    tvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilke
    pvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteav
    qkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqleke
    pivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgle
    vnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdklv
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j1eB (B:)
    gpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp
    vfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvp
    ldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiv
    iyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkw
    tvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteea
    elelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrg
    ahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvnt
    pplvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j1eB (B:)
    gpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp
    vfaikkkdstkwrklvdfrelnkrtqdfwphpaglkkkksvtvldvgdayfsvpldedfr
    kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymd
    dlyvgsdleigqhrtkieelrqhllrwggyelhpdkwtvqpivlpekdswtvndiqklvg
    klnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydps
    kdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesivi
    wgktpkfklpiqketwetwwteywqatwipewefvntpplvklwy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j1eC (C:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdi
    viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsag
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j1eC (C:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikkkdwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfr
    kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymd
    dlyvgsdleigqhrtkieelrqhllrwglttpdkhqkeppflwmgyelhpdkwtvqpivl
    pekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaen
    reilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvk
    qlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklw
    yqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylal
    qdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggne
    qvdklvsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j1eD (D:)
    gpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp
    vfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvp
    ldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiv
    iyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkw
    tvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteea
    elelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrg
    ahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvnt
    pplvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j1eD (D:)
    tvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikks
    tkwrklvdfrelnkrtqdflgiphpaglkkkksvtvldvgdayfsvpldedfrkytafti
    psinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddlyvgsd
    leigqhrtkieelrqhllrwgltgyelhpdkwtvqpivlpekdswtvndiqklvgklnwa
    sqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
    eiqkqgqgqwtyqiyqepfknlktgkyandvkqlteavqkittesiviwgktpkfklpiq
    ketwetwwteywqatwipewefvntpplvklwy